Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPS18B Peptide - N-terminal region

MRPS18B Peptide - N-terminal region

Product Specifications

Product Name Alternative

C6orf14, DKFZp564H0223, HSPC183, HumanS18a, MRP-S18-2, MRPS18-2, PTD017, S18amt

UniProt

Q9Y676

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRPS18B Rabbit Polyclonal Antibody (orb585451) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_054765

Preservative

Lyophilized powder

AA Sequence

SVPISPYKDEPWKYLESEEYQERYGSRPVWADYRRNHKGGVPPQRTRKTC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Lysophosphatidylcholine Acyltransferase (LPCAT) ELISA Kit
YP-W15765-01 48 Tests

Human Lysophosphatidylcholine Acyltransferase (LPCAT) ELISA Kit

Sign In for Pricing
View Details
Human Lysophosphatidylcholine Acyltransferase (LPCAT) ELISA Kit
YP-W15765-02 96 Tests

Human Lysophosphatidylcholine Acyltransferase (LPCAT) ELISA Kit

Sign In for Pricing
View Details
Rabbit Anti-Rat IgG (H+L) antibody (HRP)
STJ99516-100l 100 µl

Rabbit Anti-Rat IgG (H+L) antibody (HRP)

Sign In for Pricing
View Details
(R) -tert-Butyl 3- (oxetan-3-ylamino) piperidine-1-carboxylate
OR306051 1 Each

(R) -tert-Butyl 3- (oxetan-3-ylamino) piperidine-1-carboxylate

Sign In for Pricing
View Details
NUDT15 Rabbit Polyclonal Antibody
TA890049 100 µL

NUDT15 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
KIF4A Lentiviral Activation Particles (m2)
sc-421278-LAC-2 200 µL

KIF4A Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details