Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPS31 Peptide - N-terminal region

MRPS31 Peptide - N-terminal region

Product Specifications

Product Name Alternative

IMOGN38, MRP-S31, S31mt

UniProt

Q92665

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRPS31 Rabbit Polyclonal Antibody (orb585398) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005821

Preservative

Lyophilized powder

AA Sequence

LTVRHGTVRYRSSALLARTKNNIQRYFGTNSVICSKKDKQSVRTEETSKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

β-Glc-PEG3-Acid
C52215-25MG 1 Unit

β-Glc-PEG3-Acid

Sign In for Pricing
View Details
CEP68 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6D5]
TA507045BM 100 µL

CEP68 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6D5]

Sign In for Pricing
View Details
Lentiviral human ESR2 sgRNA gene knockout kit - Lentiviral human ESR2 sgRNA gene knockout kit (25)
GTR15383892 1 Vial

Lentiviral human ESR2 sgRNA gene knockout kit - Lentiviral human ESR2 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Rabbit Polyclonal OSTM1 Antibody [Allophycocyanin]
NBP2-99662APC 0.1 mL

Rabbit Polyclonal OSTM1 Antibody [Allophycocyanin]

Sign In for Pricing
View Details
Recombinant Yersinia pestis bv. Antiqua DnaA-homolog protein hda (hda)
MBS1477772-01 0.02 mg (E-Coli)

Recombinant Yersinia pestis bv. Antiqua DnaA-homolog protein hda (hda)

Sign In for Pricing
View Details
Recombinant Yersinia pestis bv. Antiqua DnaA-homolog protein hda (hda)
MBS1477772-02 0.1 mg (E-Coli)

Recombinant Yersinia pestis bv. Antiqua DnaA-homolog protein hda (hda)

Sign In for Pricing
View Details