Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPS31 Peptide - N-terminal region

MRPS31 Peptide - N-terminal region

Product Specifications

Product Name Alternative

IMOGN38, MRP-S31, S31mt

UniProt

Q92665

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRPS31 Rabbit Polyclonal Antibody (orb585398) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005821

Preservative

Lyophilized powder

AA Sequence

LTVRHGTVRYRSSALLARTKNNIQRYFGTNSVICSKKDKQSVRTEETSKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neurog2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4391806 1.0 µg DNA

Neurog2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
RAB35 Antibody
E308311 200 µL

RAB35 Antibody

Sign In for Pricing
View Details
Canine Armadillo Repeat Protein Deleted In Velo Cardio Facial Syndrome (ARVCF) ELISA Kit
MBS7261459-01 48 Well

Canine Armadillo Repeat Protein Deleted In Velo Cardio Facial Syndrome (ARVCF) ELISA Kit

Sign In for Pricing
View Details
Canine Armadillo Repeat Protein Deleted In Velo Cardio Facial Syndrome (ARVCF) ELISA Kit
MBS7261459-02 96 Well

Canine Armadillo Repeat Protein Deleted In Velo Cardio Facial Syndrome (ARVCF) ELISA Kit

Sign In for Pricing
View Details
Canine Armadillo Repeat Protein Deleted In Velo Cardio Facial Syndrome (ARVCF) ELISA Kit
MBS7261459-03 5x 96 Well

Canine Armadillo Repeat Protein Deleted In Velo Cardio Facial Syndrome (ARVCF) ELISA Kit

Sign In for Pricing
View Details
Canine Armadillo Repeat Protein Deleted In Velo Cardio Facial Syndrome (ARVCF) ELISA Kit
MBS7261459-04 10x 96 Well

Canine Armadillo Repeat Protein Deleted In Velo Cardio Facial Syndrome (ARVCF) ELISA Kit

Sign In for Pricing
View Details