Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPS9 Peptide - C-terminal region

MRPS9 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MRP-S9, RPMS9, S9mt

UniProt

P82933

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRPS9 Rabbit Polyclonal Antibody (orb585399) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_872578

Preservative

Lyophilized powder

AA Sequence

TLESKKQLIEPVQYDEQGMAFSKSEGKRKTAKAEAIVYKHGSGRIKVNGI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LTK (N-term) Rabbit Polyclonal Antibody
AP14377PU-N 400 µL

LTK (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
COQ9 Antibody
KC-1160-01 50 μL

COQ9 Antibody

Sign In for Pricing
View Details
COQ9 Antibody
KC-1160-02 100 µL

COQ9 Antibody

Sign In for Pricing
View Details
COQ9 Antibody
KC-1160-03 1 mL

COQ9 Antibody

Sign In for Pricing
View Details
Helicobacter pylori (HP/1336), CF594 conjugate, 0.1mg/mL
BNC941336-100 1x 100 µL

Helicobacter pylori (HP/1336), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PMM1 Human Gene Knockout Kit (CRISPR)
KN202004 1 Kit

PMM1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details