Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPS9 Peptide - C-terminal region

MRPS9 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MRP-S9, RPMS9, S9mt

UniProt

P82933

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRPS9 Rabbit Polyclonal Antibody (orb585399) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_872578

Preservative

Lyophilized powder

AA Sequence

TLESKKQLIEPVQYDEQGMAFSKSEGKRKTAKAEAIVYKHGSGRIKVNGI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C9orf89 (CARD19) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3B3]
TA811305AM 100 µL

C9orf89 (CARD19) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3B3]

Sign In for Pricing
View Details
Cst13 (NM_027024) Mouse Tagged ORF Clone
MG200903 10 µg

Cst13 (NM_027024) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Spsb2 Mouse Gene Knockout Kit (CRISPR)
KN516676 1 Kit

Spsb2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Standard Fume Hood BFSD-404
BFSD-404 1 Unit

Standard Fume Hood BFSD-404

Sign In for Pricing
View Details
b-Phenylethyl Furoate
TRC-P400613-50G 50 g

b-Phenylethyl Furoate

Sign In for Pricing
View Details
CD5 (CD5/54/F6), CF647 conjugate, 0.1mg/mL
BNC470746-100 1x 100 µL

CD5 (CD5/54/F6), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details