Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRTO4 Peptide - middle region

MRTO4 Peptide - middle region

Product Specifications

Product Name Alternative

C1orf33, MRT4, dJ657E11.4

UniProt

Q9UKD2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRTO4 Rabbit Polyclonal Antibody (orb579726) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057267

Preservative

Lyophilized powder

AA Sequence

EQFPHSMEPQLRQLGLPTALKRGVVTLLSDYEVCKEGDVLTPEQARVLKL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

hsa-miR-4755-3p miRNA Antagomir
MNH02653 2x 5.0 nmol

hsa-miR-4755-3p miRNA Antagomir

Sign In for Pricing
View Details
Atp11a (NM_001293667) Mouse Untagged Clone
MC229407 10 µg

Atp11a (NM_001293667) Mouse Untagged Clone

Sign In for Pricing
View Details
CPT1B-specific antibody
FNab01944 100 µg

CPT1B-specific antibody

Sign In for Pricing
View Details
Anti-ELAVL1 Polyclonal Antibody
TMAB-05531-01 50 μL

Anti-ELAVL1 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-ELAVL1 Polyclonal Antibody
TMAB-05531-02 100 µL

Anti-ELAVL1 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-ELAVL1 Polyclonal Antibody
TMAB-05531-03 200 µL

Anti-ELAVL1 Polyclonal Antibody

Sign In for Pricing
View Details