Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRTO4 Peptide - middle region

MRTO4 Peptide - middle region

Product Specifications

Product Name Alternative

C1orf33, MRT4, dJ657E11.4

UniProt

Q9UKD2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRTO4 Rabbit Polyclonal Antibody (orb579726) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057267

Preservative

Lyophilized powder

AA Sequence

EQFPHSMEPQLRQLGLPTALKRGVVTLLSDYEVCKEGDVLTPEQARVLKL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tie2 (Phospho-Ser1119) Rabbit Polyclonal Antibody
BT-AP05107-01 20 µL

Tie2 (Phospho-Ser1119) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tie2 (Phospho-Ser1119) Rabbit Polyclonal Antibody
BT-AP05107-02 50 µL

Tie2 (Phospho-Ser1119) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tie2 (Phospho-Ser1119) Rabbit Polyclonal Antibody
BT-AP05107-03 100 µL

Tie2 (Phospho-Ser1119) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
XKRX, CT (XKRX, XKR2, XPLAC, XRG2, XK-related protein 2, Membrane protein XPLAC, X Kell blood group-related, X-linked) (MaxLight 490)
MBS6363990-01 0.1 mL

XKRX, CT (XKRX, XKR2, XPLAC, XRG2, XK-related protein 2, Membrane protein XPLAC, X Kell blood group-related, X-linked) (MaxLight 490)

Sign In for Pricing
View Details
XKRX, CT (XKRX, XKR2, XPLAC, XRG2, XK-related protein 2, Membrane protein XPLAC, X Kell blood group-related, X-linked) (MaxLight 490)
MBS6363990-02 5x 0.1 mL

XKRX, CT (XKRX, XKR2, XPLAC, XRG2, XK-related protein 2, Membrane protein XPLAC, X Kell blood group-related, X-linked) (MaxLight 490)

Sign In for Pricing
View Details
Human Adiponectin/Acrp30 Affinity Purified Polyclonal Ab
AF1065 100 µg

Human Adiponectin/Acrp30 Affinity Purified Polyclonal Ab

Sign In for Pricing
View Details