Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Msn Peptide - C-terminal region

Msn Peptide - C-terminal region

Product Specifications

Product Name Alternative

C78546

UniProt

P26041

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Msn Rabbit Polyclonal Antibody (orb330829) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034963

Preservative

Lyophilized powder

AA Sequence

SELANARDESKKTANDMIHAENMRLGRDKYKTLRQIRQGNTKQRIDEFES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Angiotensin-converting enzyme 2 (ACE2) Antibody (FITC)
abx346373-01 50 µL

Angiotensin-converting enzyme 2 (ACE2) Antibody (FITC)

Sign In for Pricing
View Details
Angiotensin-converting enzyme 2 (ACE2) Antibody (FITC)
abx346373-02 100 µL

Angiotensin-converting enzyme 2 (ACE2) Antibody (FITC)

Sign In for Pricing
View Details
Angiotensin-converting enzyme 2 (ACE2) Antibody (FITC)
abx346373-03 200 µL

Angiotensin-converting enzyme 2 (ACE2) Antibody (FITC)

Sign In for Pricing
View Details
Angiotensin-converting enzyme 2 (ACE2) Antibody (FITC)
abx346373-04 1 mL

Angiotensin-converting enzyme 2 (ACE2) Antibody (FITC)

Sign In for Pricing
View Details
MDM2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI20D1]
TA804713BM 100 µL

MDM2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI20D1]

Sign In for Pricing
View Details
MCM8 Peptide - N-terminal region (AAP36658)
AAP36658-100UG 100 µg

MCM8 Peptide - N-terminal region (AAP36658)

Sign In for Pricing
View Details