Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Msn Peptide - C-terminal region

Msn Peptide - C-terminal region

Product Specifications

Product Name Alternative

C78546

UniProt

P26041

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Msn Rabbit Polyclonal Antibody (orb330829) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034963

Preservative

Lyophilized powder

AA Sequence

SELANARDESKKTANDMIHAENMRLGRDKYKTLRQIRQGNTKQRIDEFES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adamts15 Mouse Gene Knockout Kit (CRISPR)
KN500853 1 Kit

Adamts15 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Guinea-pig GAL7 (Galectin 7) ValidElisa Kit
EK347271 96 Well

Guinea-pig GAL7 (Galectin 7) ValidElisa Kit

Sign In for Pricing
View Details
Recombinant Human PEX12 Protein, N-GST & C-His
AP97381 50 µg

Recombinant Human PEX12 Protein, N-GST & C-His

Sign In for Pricing
View Details
ZCCHC4 Human shRNA Lentiviral Particle (Locus ID 29063)
TL317503V 500 µL Each

ZCCHC4 Human shRNA Lentiviral Particle (Locus ID 29063)

Sign In for Pricing
View Details
Human Claudin 3 (CLDN3) ELISA Kit
EKU03207 96 Tests

Human Claudin 3 (CLDN3) ELISA Kit

Sign In for Pricing
View Details
ATG7 Protein Vector (Mouse) (pPB-N-His)
PV157051 500 ng

ATG7 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details