Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MSRA Peptide - middle region

MSRA Peptide - middle region

Product Specifications

Product Name Alternative

PMSR

UniProt

Q9UJ68

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MSRA Rabbit Polyclonal Antibody (orb583286) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036463

Preservative

Lyophilized powder

AA Sequence

YQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SAV1 Rabbit pAb, BF700 conjugated
orb2844553 100 µL

SAV1 Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
MADH7/Smad7
E8ER1912-61 100 µL

MADH7/Smad7

Sign In for Pricing
View Details
Recombinant Klebsiella Pneumoniae atpC Protein (aa 1-139)
VAng-Cr4672-500gEcoli 500 µg (E. coli)

Recombinant Klebsiella Pneumoniae atpC Protein (aa 1-139)

Sign In for Pricing
View Details
Porcine Ribonuclease Inhibitor (RNH1) ELISA Kit-Sandwich
EK12F668-01 48 Test

Porcine Ribonuclease Inhibitor (RNH1) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Porcine Ribonuclease Inhibitor (RNH1) ELISA Kit-Sandwich
EK12F668-02 96 Tests

Porcine Ribonuclease Inhibitor (RNH1) ELISA Kit-Sandwich

Sign In for Pricing
View Details
SH3GL3 Antibody
E94112 100 µg

SH3GL3 Antibody

Sign In for Pricing
View Details