Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MSRA Peptide - middle region

MSRA Peptide - middle region

Product Specifications

Product Name Alternative

PMSR

UniProt

Q9UJ68

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MSRA Rabbit Polyclonal Antibody (orb583286) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036463

Preservative

Lyophilized powder

AA Sequence

YQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APOA2 Antibody (Center)
MBS9214364-01 0.08 mL

APOA2 Antibody (Center)

Sign In for Pricing
View Details
APOA2 Antibody (Center)
MBS9214364-02 0.4 mL

APOA2 Antibody (Center)

Sign In for Pricing
View Details
APOA2 Antibody (Center)
MBS9214364-03 5x 0.4 mL

APOA2 Antibody (Center)

Sign In for Pricing
View Details
FAM111B Antibody
A26094-100UG 100 µg

FAM111B Antibody

Sign In for Pricing
View Details
GlycoBind Binding Buffer - Con A
21510892-3 100 mL

GlycoBind Binding Buffer - Con A

Sign In for Pricing
View Details
Bromo-PEG1-CH2CO2tBu
JH914725 1 Each

Bromo-PEG1-CH2CO2tBu

Sign In for Pricing
View Details