Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTFR1 Peptide - C-terminal region

MTFR1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CHPPR, FAM54A2, KIAA0009

UniProt

Q9NRX1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MTFR1 Rabbit Polyclonal Antibody (orb585373) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_064528

Preservative

Lyophilized powder

AA Sequence

LGLHQSTSAVDLIKERREKRANAGKTLVKNNPKKPEMPNMLEILKEMNSV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NCOA4P1 ORF Vector (Human) (pORF)
ORF025972 1.0 µg DNA

NCOA4P1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
ICK (Intestinal Cell Kinase, hICK, ECO, KIAA0936, Laryngeal Cancer Kinase 2, LCK2, MAK-related Kinase, MRK, MGC46090, Serine/Threonine-protein Kinase ICK)
128194 100 µg

ICK (Intestinal Cell Kinase, hICK, ECO, KIAA0936, Laryngeal Cancer Kinase 2, LCK2, MAK-related Kinase, MRK, MGC46090, Serine/Threonine-protein Kinase ICK)

Sign In for Pricing
View Details
Recombinant Bovine Metalloproteinase inhibitor 4 (TIMP4), N-His
AP7F103-01 1 mg

Recombinant Bovine Metalloproteinase inhibitor 4 (TIMP4), N-His

Sign In for Pricing
View Details
Recombinant Bovine Metalloproteinase inhibitor 4 (TIMP4), N-His
AP7F103-02 10 µg

Recombinant Bovine Metalloproteinase inhibitor 4 (TIMP4), N-His

Sign In for Pricing
View Details
Recombinant Bovine Metalloproteinase inhibitor 4 (TIMP4), N-His
AP7F103-03 200 µg

Recombinant Bovine Metalloproteinase inhibitor 4 (TIMP4), N-His

Sign In for Pricing
View Details
Recombinant Bovine Metalloproteinase inhibitor 4 (TIMP4), N-His
AP7F103-04 5 mg

Recombinant Bovine Metalloproteinase inhibitor 4 (TIMP4), N-His

Sign In for Pricing
View Details