MTG1 Peptide - N-terminal region
MTG1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
GTP, GTPBP7, RP11-108K14.2
UniProt
Q9BT17
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MTG1 Rabbit Polyclonal Antibody (orb585297) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_612393
Preservative
Lyophilized powder
AA Sequence
IMQHLEGEGLKNVIFTNCVKDENVKQIIPMVTELIGRSHRYHRKENLEYC
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC471003-500 1x 500 µL
Mucin 5AC (MUC5AC) (58M1), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740276-100 1x 100 µL
TAG-72 / CA72.4 (B72.3), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881429-500 1x 500 µL
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940096-500 1x 500 µL
Histone H1 (AE-4), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 