Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTG1 Peptide - middle region

MTG1 Peptide - middle region

Product Specifications

Product Name Alternative

GTP, GTPBP7, RP11-108K14.2

UniProt

Q9BT17

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MTG1 Rabbit Polyclonal Antibody (orb585298) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_612393

Preservative

Lyophilized powder

AA Sequence

MVIGVPNVGKSSLINSLRRQHLRKGKATRVGGEPGITRAVMSKIQVSERP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® 647 Anti-Mouse CD272 Antibody[6F7]
AN00415UM-01 25 µg

Elab Fluor® 647 Anti-Mouse CD272 Antibody[6F7]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD272 Antibody[6F7]
AN00415UM-02 100 µg

Elab Fluor® 647 Anti-Mouse CD272 Antibody[6F7]

Sign In for Pricing
View Details
B3GNTL1 Human Gene Knockout Kit (CRISPR)
KN415480 1 Kit

B3GNTL1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
rel-(1R,3S)-cyclopentane-1,3-dicarboxylic Acid
TRC-R160711-500MG 500 mg

rel-(1R,3S)-cyclopentane-1,3-dicarboxylic Acid

Sign In for Pricing
View Details
ADAM23 Human Gene Knockout Kit (CRISPR)
KN422765 1 Kit

ADAM23 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Maltase Activity Assay Kit
E-BC-K041-M 96 T (40 samples)

Maltase Activity Assay Kit

Sign In for Pricing
View Details