MTG1 Peptide - middle region
MTG1 Peptide - middle region
Product Specifications
Product Name Alternative
GTP, GTPBP7, RP11-108K14.2
UniProt
Q9BT17
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MTG1 Rabbit Polyclonal Antibody (orb585298) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_612393
Preservative
Lyophilized powder
AA Sequence
MVIGVPNVGKSSLINSLRRQHLRKGKATRVGGEPGITRAVMSKIQVSERP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
HP220695 200 Reactions
LOC553137 Human qPCR Primer Pair (NR_015365)
Sign In for Pricing
View Details 
BNC041994-100 1x 100 µL
MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (MMP3/1994R), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
TRC-H825228-1MG 1 mg
4’-Hydroxy Diclofenac-13C6 (Contain 3% unlabeled)
Sign In for Pricing
View Details 