MTMR14 Peptide - middle region
MTMR14 Peptide - middle region
Product Specifications
Product Name Alternative
C3orf29, FLJ22405, FLJ90311, hEDTP
UniProt
Q8NCE2
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MTMR14 Rabbit Polyclonal Antibody (orb583648) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001070993
Preservative
Lyophilized powder
AA Sequence
NFLKHITSEEFSALKTQRRKSLPARDGGFTLEDICMLRRKDRGSTTSLGS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Mouse IL-6 Recombinant Rabbit Monoclonal Antibody [PSH0-58] - BSA and Azide free (Capture)](https://cdn.genprice.uk/products/992/68dd1c8b061270361ea81899/imageurl/ha721411.webp)
HA721411 100 µL
Mouse IL-6 Recombinant Rabbit Monoclonal Antibody [PSH0-58] - BSA and Azide free (Capture)
Sign In for Pricing
View Details 
BNC401948-500 1x 500 µL
Cytokeratin 10 (Suprabasal Epithelial Marker) (KRT10/1948R), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
