Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTMR14 Peptide - middle region

MTMR14 Peptide - middle region

Product Specifications

Product Name Alternative

C3orf29, FLJ22405, FLJ90311, hEDTP

UniProt

Q8NCE2

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MTMR14 Rabbit Polyclonal Antibody (orb583648) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001070993

Preservative

Lyophilized powder

AA Sequence

NFLKHITSEEFSALKTQRRKSLPARDGGFTLEDICMLRRKDRGSTTSLGS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD4 (NM_001195014) Human Over-expression Lysate
LY434120 100 µg

CD4 (NM_001195014) Human Over-expression Lysate

Sign In for Pricing
View Details
EPLIN (LIMA1) Mouse Monoclonal Antibody [Clone ID: OTI9F3]
CF808560 100 µg

EPLIN (LIMA1) Mouse Monoclonal Antibody [Clone ID: OTI9F3]

Sign In for Pricing
View Details
RIP3 Recombinant Rabbit monoclonal Antibody
HA750973 100 µL

RIP3 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Human COA5 activation kit by CRISPRa
GA118576 1 Kit

Human COA5 activation kit by CRISPRa

Sign In for Pricing
View Details
Human Stabilin 2 (STAB2) activation kit by CRISPRa
GA110798 1 Kit

Human Stabilin 2 (STAB2) activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant COPS8 Antibody
RC-4049-01 50 μL

Recombinant COPS8 Antibody

Sign In for Pricing
View Details