Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTMR6 Peptide - C-terminal region

MTMR6 Peptide - C-terminal region

Product Specifications

UniProt

Q9Y217

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MTMR6 Rabbit Polyclonal Antibody (orb585252) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004676

Preservative

Lyophilized powder

AA Sequence

KDLESKIKQRKNKQTDGILTKELLHSVHPESPNLKTSLCFKEQTLLPVND

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gremlin 1 (GREM1) Rabbit Polyclonal Antibody
AP26028PU-N 100 µg

Gremlin 1 (GREM1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MBP, AlpHcAbs® Rabbit antibody (HRP)
HA710085 100 µg

MBP, AlpHcAbs® Rabbit antibody (HRP)

Sign In for Pricing
View Details
PTFE-Coated Sealing Mats
MAT-SQ-96-PTFE 50 Pack/Case

PTFE-Coated Sealing Mats

Sign In for Pricing
View Details
C16orf48 (ENKD1) Human Gene Knockout Kit (CRISPR)
KN402535 1 Kit

C16orf48 (ENKD1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Atp13a2 Mouse Gene Knockout Kit (CRISPR)
KN501764 1 Kit

Atp13a2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
5-Fluoroindole-3-butyric Acid
TRC-F402818-500MG 500 mg

5-Fluoroindole-3-butyric Acid

Sign In for Pricing
View Details