Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTMR6 Peptide - C-terminal region

MTMR6 Peptide - C-terminal region

Product Specifications

UniProt

Q9Y217

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MTMR6 Rabbit Polyclonal Antibody (orb585252) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004676

Preservative

Lyophilized powder

AA Sequence

KDLESKIKQRKNKQTDGILTKELLHSVHPESPNLKTSLCFKEQTLLPVND

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Indole-3-Acetic-d2 Acid
TRC-I708205-2MG 2 mg

Indole-3-Acetic-d2 Acid

Sign In for Pricing
View Details
Copper (II) trifluoroacetate hydrate
TRC-C685403-500MG 500 mg

Copper (II) trifluoroacetate hydrate

Sign In for Pricing
View Details
PSMA1 Recombinant Rabbit Monoclonal Antibody [JU66-24]
ET1706-19 100 µL

PSMA1 Recombinant Rabbit Monoclonal Antibody [JU66-24]

Sign In for Pricing
View Details
WWP1 Rabbit Polyclonal Antibody
TA369478 100 µL

WWP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tram1 Mouse Gene Knockout Kit (CRISPR)
KN518135 1 Kit

Tram1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ANKRD12 Human Gene Knockout Kit (CRISPR)
KN423338 1 Kit

ANKRD12 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details