Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTRR Peptide - N-terminal region

MTRR Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC129643, MSR, cblE

UniProt

Q9UBK8

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MTRR Rabbit Polyclonal Antibody (orb326228) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_076915

Preservative

Lyophilized powder

AA Sequence

YDLKTETAPLVVVVSTTGTGDPPDTARKFVKEIQNQTLPVDFFAHLRYGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclin B1 (CCNB1) pSer147 Rabbit Polyclonal Antibody
AP09487PU-N 100 µL

Cyclin B1 (CCNB1) pSer147 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human NIPAL3 activation kit by CRISPRa
GA111434 1 Kit

Human NIPAL3 activation kit by CRISPRa

Sign In for Pricing
View Details
Poly-L-arginine Coated - 96 well Solid plates - Black PS
MCB13F-AR 10x 96 Well Plates

Poly-L-arginine Coated - 96 well Solid plates - Black PS

Sign In for Pricing
View Details
RNF20 Human Gene Knockout Kit (CRISPR)
KN418422 1 Kit

RNF20 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary
CS629704 5x 5 µm

Frozen Tissue Sections, Ovary

Sign In for Pricing
View Details
Isovaleric anhydride
TRC-I917578-2.5G 2.5 g

Isovaleric anhydride

Sign In for Pricing
View Details