Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTUS2 Peptide - C-terminal region

MTUS2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CAZIP, KIAA0774, TIP150

UniProt

Q5JR59

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MTUS2 Rabbit Polyclonal Antibody (orb585440) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056048

Preservative

Lyophilized powder

AA Sequence

LKARIDQNTVVTRQLSEENANLQEYVEKETQEKKRLSRTNEELLWKLQTG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

USF2 (NM_207291) Human Over-expression Lysate
LY404074 100 µg

USF2 (NM_207291) Human Over-expression Lysate

Sign In for Pricing
View Details
Striatin3 (STRN3) Human Gene Knockout Kit (CRISPR)
KN415262 1 Kit

Striatin3 (STRN3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RNF115 Antibody
KC-26426-01 50 μL

RNF115 Antibody

Sign In for Pricing
View Details
RNF115 Antibody
KC-26426-02 100 µL

RNF115 Antibody

Sign In for Pricing
View Details
RNF115 Antibody
KC-26426-03 1 mL

RNF115 Antibody

Sign In for Pricing
View Details
CD163 (Monocyte & Macrophage Marker) (M130/2162), CF488A conjugate, 0.1mg/mL
BNC882162-500 1x 500 µL

CD163 (Monocyte & Macrophage Marker) (M130/2162), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details