Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTUS2 Peptide - C-terminal region

MTUS2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CAZIP, KIAA0774, TIP150

UniProt

Q5JR59

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MTUS2 Rabbit Polyclonal Antibody (orb585440) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056048

Preservative

Lyophilized powder

AA Sequence

LKARIDQNTVVTRQLSEENANLQEYVEKETQEKKRLSRTNEELLWKLQTG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Prostate
CS802659 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Human Endostatin (COL18A1) activation kit by CRISPRa
GA112983 1 Kit

Human Endostatin (COL18A1) activation kit by CRISPRa

Sign In for Pricing
View Details
MOX1 (MEOX1) (NM_004527) Human Recombinant Protein
TP310106 20 µg

MOX1 (MEOX1) (NM_004527) Human Recombinant Protein

Sign In for Pricing
View Details
Eph receptor B4 (EPHB4) Human Knockdown Lysate
LY300159 100 µg

Eph receptor B4 (EPHB4) Human Knockdown Lysate

Sign In for Pricing
View Details
Beta Tubulin Monoclonal Antibody
E-AB-20033-01 30 µL

Beta Tubulin Monoclonal Antibody

Sign In for Pricing
View Details
Beta Tubulin Monoclonal Antibody
E-AB-20033-02 60 µL

Beta Tubulin Monoclonal Antibody

Sign In for Pricing
View Details