Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MUSK Peptide - N-terminal region

MUSK Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC126323, MGC126324

UniProt

O15146

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MUSK Rabbit Polyclonal Antibody (orb585519) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001159753

Preservative

Lyophilized powder

AA Sequence

ENSRIAVLESGSLRIHNVQKEDAGQYRCVAKNSLGTAYSKVVKLEVEVFA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DCDC5 (NM_020869) Human Over-expression Lysate
LY434455 100 µg

DCDC5 (NM_020869) Human Over-expression Lysate

Sign In for Pricing
View Details
4-phenyl-2,3-dihydroquinazolin-2-one
TRC-P322943-50MG 50 mg

4-phenyl-2,3-dihydroquinazolin-2-one

Sign In for Pricing
View Details
LRRC57 (C-term) Rabbit Polyclonal Antibody
AP52542PU-N 400 µL

LRRC57 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
3,3,4,4,5,5,6,6,7,7,8,8,8-Tridecafluorooctane-1-sulphonic Acid
TRC-T007805-25MG 25 mg

3,3,4,4,5,5,6,6,7,7,8,8,8-Tridecafluorooctane-1-sulphonic Acid

Sign In for Pricing
View Details
C14orf93 Human Gene Knockout Kit (CRISPR)
KN421403 1 Kit

C14orf93 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Liver
CS705703 5x 5 µm

Tissue FFPE Sections, Liver

Sign In for Pricing
View Details