Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MUSK Peptide - N-terminal region

MUSK Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC126323, MGC126324

UniProt

O15146

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MUSK Rabbit Polyclonal Antibody (orb585519) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001159753

Preservative

Lyophilized powder

AA Sequence

ENSRIAVLESGSLRIHNVQKEDAGQYRCVAKNSLGTAYSKVVKLEVEVFA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement C4d (C4D205), CF568 conjugate, 0.1mg/mL
BNC680205-500 1x 500 µL

Complement C4d (C4D205), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PHT-427
TRC-P399158-10MG 10 mg

PHT-427

Sign In for Pricing
View Details
FADS1 Mouse Monoclonal Antibody [Clone ID: 2D9]
AM31762PU-N 50 µg

FADS1 Mouse Monoclonal Antibody [Clone ID: 2D9]

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2729R), CF568 conjugate, 0.1mg/mL
BNC682729-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2729R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
1-Pyridin-2-yl-propan-2-one
TRC-A521118-50MG 50 mg

1-Pyridin-2-yl-propan-2-one

Sign In for Pricing
View Details
Recombinant GSDMD Antibody
RC-6380-01 50 μL

Recombinant GSDMD Antibody

Sign In for Pricing
View Details