Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MUTED Peptide - C-terminal region

MUTED Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp686E2287, MU, MUTED

UniProt

Q8TDH9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MUTED Rabbit Polyclonal Antibody (orb585590) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_958437

Preservative

Lyophilized powder

AA Sequence

QQREQERKKIHSDHLVASEKQHMLQWDNFMKEQPNKRAEVDEEHRKAMER

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RALGDS (NM_001042368) Human Over-expression Lysate
LY420857 100 µg

RALGDS (NM_001042368) Human Over-expression Lysate

Sign In for Pricing
View Details
(S)-Perillaldehyde (92%)
TRC-E560003-500MG 500 mg

(S)-Perillaldehyde (92%)

Sign In for Pricing
View Details
PLK4 Mouse Monoclonal Antibody [Clone ID: OTI2D12]
CF810507 100 µg

PLK4 Mouse Monoclonal Antibody [Clone ID: OTI2D12]

Sign In for Pricing
View Details
Amplite® Colorimetric NADP/NADPH Ratio Assay Kit
15274-AAT 250 Tests

Amplite® Colorimetric NADP/NADPH Ratio Assay Kit

Sign In for Pricing
View Details
Recombinant Human ENO1 protein (GST tag)
PDEH101092-01 20 µg

Recombinant Human ENO1 protein (GST tag)

Sign In for Pricing
View Details
Recombinant Human ENO1 protein (GST tag)
PDEH101092-02 100 µg

Recombinant Human ENO1 protein (GST tag)

Sign In for Pricing
View Details