Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MVD Peptide - N-terminal region

MVD Peptide - N-terminal region

Product Specifications

Product Name Alternative

FP17780, MPD

UniProt

P53602

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MVD Rabbit Polyclonal Antibody (orb584890) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002452

Preservative

Lyophilized powder

AA Sequence

VGQPRLQACLREIRCLARKRRNSRDGDPLPSSLSCKVHVASVNNFPTAAG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGD1309594 (NM_001008351) Rat Tagged ORF Clone Lentiviral Particle
RR211129L4V 200 µL

RGD1309594 (NM_001008351) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Proton channel OTOP1 (otop1) Antibody
abx346952-01 20 µL

Proton channel OTOP1 (otop1) Antibody

Sign In for Pricing
View Details
Proton channel OTOP1 (otop1) Antibody
abx346952-02 50 µL

Proton channel OTOP1 (otop1) Antibody

Sign In for Pricing
View Details
Proton channel OTOP1 (otop1) Antibody
abx346952-03 100 µL

Proton channel OTOP1 (otop1) Antibody

Sign In for Pricing
View Details
Proton channel OTOP1 (otop1) Antibody
abx346952-04 200 µL

Proton channel OTOP1 (otop1) Antibody

Sign In for Pricing
View Details
Proton channel OTOP1 (otop1) Antibody
abx346952-05 1 mL

Proton channel OTOP1 (otop1) Antibody

Sign In for Pricing
View Details