Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MVD Peptide - N-terminal region

MVD Peptide - N-terminal region

Product Specifications

Product Name Alternative

FP17780, MPD

UniProt

P53602

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MVD Rabbit Polyclonal Antibody (orb584890) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002452

Preservative

Lyophilized powder

AA Sequence

VGQPRLQACLREIRCLARKRRNSRDGDPLPSSLSCKVHVASVNNFPTAAG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ovine Inhibin Beta A Chain (INHBA) ELISA Kit-Sandwich
EK8F405-01 48 Test

Ovine Inhibin Beta A Chain (INHBA) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Ovine Inhibin Beta A Chain (INHBA) ELISA Kit-Sandwich
EK8F405-02 96 Tests

Ovine Inhibin Beta A Chain (INHBA) ELISA Kit-Sandwich

Sign In for Pricing
View Details
RAB18 (Ras-related Protein Rab-18, RAB18LI1, WARBM3) (MaxLight 750)
MBS6234814-01 0.1 mL

RAB18 (Ras-related Protein Rab-18, RAB18LI1, WARBM3) (MaxLight 750)

Sign In for Pricing
View Details
RAB18 (Ras-related Protein Rab-18, RAB18LI1, WARBM3) (MaxLight 750)
MBS6234814-02 5x 0.1 mL

RAB18 (Ras-related Protein Rab-18, RAB18LI1, WARBM3) (MaxLight 750)

Sign In for Pricing
View Details
FLI1 Rabbit pAb
A5644-01 20 µL

FLI1 Rabbit pAb

Sign In for Pricing
View Details
FLI1 Rabbit pAb
A5644-02 100 μL

FLI1 Rabbit pAb

Sign In for Pricing
View Details