Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mxd1 Peptide - C-terminal region

Mxd1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AW122478, Mad, Mad1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Mxd1 Rabbit Polyclonal Antibody (orb576544) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034881

Preservative

Lyophilized powder

AA Sequence

VDVDVDVDVDVEGTDYLNGDLGWSSSVSDSDERGSMQSLGSDEGYSSATV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARID1A Antibody
KC-12537-01 50 μL

ARID1A Antibody

Sign In for Pricing
View Details
ARID1A Antibody
KC-12537-02 100 µL

ARID1A Antibody

Sign In for Pricing
View Details
ARID1A Antibody
KC-12537-03 1 mL

ARID1A Antibody

Sign In for Pricing
View Details
Recombinant Podoplanin Antibody
RC-16418-01 50 μL

Recombinant Podoplanin Antibody

Sign In for Pricing
View Details
Recombinant Podoplanin Antibody
RC-16418-02 100 µL

Recombinant Podoplanin Antibody

Sign In for Pricing
View Details
Recombinant Podoplanin Antibody
RC-16418-03 1 mL

Recombinant Podoplanin Antibody

Sign In for Pricing
View Details