Mxd1 Peptide - C-terminal region
Mxd1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
AW122478, Mad, Mad1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Mxd1 Rabbit Polyclonal Antibody (orb576544) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_034881
Preservative
Lyophilized powder
AA Sequence
VDVDVDVDVDVEGTDYLNGDLGWSSSVSDSDERGSMQSLGSDEGYSSATV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC403605-100 1x 100 µL
EGFR (Epidermal Growth Factor Receptor) (rGFR/1667), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
