Mybbp1a Peptide - middle region
Mybbp1a Peptide - middle region
Product Specifications
Product Name Alternative
AL024407, AU019902, P160, p160MBP, p67MBP
UniProt
O35821
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Mybbp1a Rabbit Polyclonal Antibody (orb576249) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_058056
Preservative
Lyophilized powder
AA Sequence
EKKNAKDIPSDTQSPVSTKRKKKGFLPETKKRKKLKSEGTTPEKNAASQQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15374418 1 Vial
Lentiviral human CORO1C sgRNA gene knockout kit - Lentiviral human CORO1C sgRNA gene knockout kit (25)
Sign In for Pricing
View Details LV670950 1.0 µg DNA
ADAR Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
Sign In for Pricing
View Details 
132719-AP 100 µL
ROBO3 (Roundabout Homolog 3, Roundabout-like Protein 3, HGPS, HGPPS, RBIG1, RIG1) (AP) discontinued
Sign In for Pricing
View Details 
MBS064212 Inquire
Chicken Transforming Growth Factor Beta Receptor I ELISA Kit
Sign In for Pricing
View Details