Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYBPH Peptide - middle region

MYBPH Peptide - middle region

Product Specifications

UniProt

Q13203

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MYBPH Rabbit Polyclonal Antibody (orb326112) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004988

Preservative

Lyophilized powder

AA Sequence

APKIRVPRHLRQTYIRQVGETVNLQIPFQGKPKPQATWTHNGHALDSQRV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Escherichia coli O139:H28 (strain E24377A/ETEC) LPLA Polyclonal Antibody
MBS7169582 Inquire

Rabbit anti-Escherichia coli O139:H28 (strain E24377A/ETEC) LPLA Polyclonal Antibody

Sign In for Pricing
View Details
HSD17B10 Antibody
orb1275896 100 µL

HSD17B10 Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal EBAG9/RCAS1 Antibody [DyLight 350]
NBP3-00242UV 0.1 mL

Rabbit Polyclonal EBAG9/RCAS1 Antibody [DyLight 350]

Sign In for Pricing
View Details
VEGFA Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV699129 1.0 µg DNA

VEGFA Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
NDUFA9 Polyclonal Antibody
MBS2540103-01 0.06 mL

NDUFA9 Polyclonal Antibody

Sign In for Pricing
View Details
NDUFA9 Polyclonal Antibody
MBS2540103-02 0.12 mL

NDUFA9 Polyclonal Antibody

Sign In for Pricing
View Details