Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Myocd Peptide - N-terminal region

Myocd Peptide - N-terminal region

Product Specifications

Product Name Alternative

BSAC2A, Srfcp, Myocd

UniProt

Q8VIM5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Myocd Rabbit Polyclonal Antibody (orb325606) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_660118

Preservative

Lyophilized powder

AA Sequence

KSLGDSKNRHKKPKDPKPKVKKLKYHQYIPPDQKAEKSPPPMDSAYARLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VILIP1 (VSNL1) Mouse Monoclonal Antibody [Clone ID: LBI6B11]
AMM15298V 100 µL

VILIP1 (VSNL1) Mouse Monoclonal Antibody [Clone ID: LBI6B11]

Sign In for Pricing
View Details
Human Histone H1x, H1FX ELISA Kit
MBS9331732-01 48 Well

Human Histone H1x, H1FX ELISA Kit

Sign In for Pricing
View Details
Human Histone H1x, H1FX ELISA Kit
MBS9331732-02 96 Well

Human Histone H1x, H1FX ELISA Kit

Sign In for Pricing
View Details
Human Histone H1x, H1FX ELISA Kit
MBS9331732-03 5x 96 Well

Human Histone H1x, H1FX ELISA Kit

Sign In for Pricing
View Details
Human Histone H1x, H1FX ELISA Kit
MBS9331732-04 10x 96 Well

Human Histone H1x, H1FX ELISA Kit

Sign In for Pricing
View Details
Adi1 ORF Vector (Mouse) (pORF)
ORF038174 1.0 µg DNA

Adi1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details