Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYPN Peptide - C-terminal region

MYPN Peptide - C-terminal region

Product Specifications

Product Name Alternative

MYOP

UniProt

Q86TC9

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MYPN Rabbit Polyclonal Antibody (orb584650) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115967

Preservative

Lyophilized powder

AA Sequence

PVPKVYWFKDGKQISKRNEHCKMRREGDGTCSLHIESTTSDDDGNYTIMA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Human KCNJ4 pAb
PA16573-01 50 μL

Rabbit Anti-Human KCNJ4 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human KCNJ4 pAb
PA16573-02 100 μL

Rabbit Anti-Human KCNJ4 pAb

Sign In for Pricing
View Details
Strumpellin HDR Plasmid (h2)
sc-402808-HDR-2 20 µg

Strumpellin HDR Plasmid (h2)

Sign In for Pricing
View Details
Mouse Monoclonal Daxx Antibody (DAXX-01) [Alexa Fluor 532]
NB500-491AF532 0.1 mL

Mouse Monoclonal Daxx Antibody (DAXX-01) [Alexa Fluor 532]

Sign In for Pricing
View Details
Mouse Chlamydial protease like activity factor ELISA kit
GTR10404170 96 Well

Mouse Chlamydial protease like activity factor ELISA kit

Sign In for Pricing
View Details
2,6-Difluorophenylacetic acid
PC2874D-01 5 g

2,6-Difluorophenylacetic acid

Sign In for Pricing
View Details