Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYPN Peptide - C-terminal region

MYPN Peptide - C-terminal region

Product Specifications

Product Name Alternative

MYOP

UniProt

Q86TC9

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MYPN Rabbit Polyclonal Antibody (orb584650) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115967

Preservative

Lyophilized powder

AA Sequence

PVPKVYWFKDGKQISKRNEHCKMRREGDGTCSLHIESTTSDDDGNYTIMA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Annexin A4 (ANXA4) Porcine ELISA Kit
B5335 96 Tests

Annexin A4 (ANXA4) Porcine ELISA Kit

Sign In for Pricing
View Details
PCMV-EGFP-LIPI-3xHA-Neo Plasmid
PVT71220 2 µg

PCMV-EGFP-LIPI-3xHA-Neo Plasmid

Sign In for Pricing
View Details
SCN8A (Sodium Channel Protein Type 8 Subunit alpha, Sodium Channel Protein Type VIII Subunit alpha, Voltage-gated Sodium Channel Subunit alpha Nav1.6, MED) (MaxLight 490)
133026-ML490 100 µL

SCN8A (Sodium Channel Protein Type 8 Subunit alpha, Sodium Channel Protein Type VIII Subunit alpha, Voltage-gated Sodium Channel Subunit alpha Nav1.6, MED) (MaxLight 490)

Sign In for Pricing
View Details
Sudan Red 7B
GT0394-25g 25 g

Sudan Red 7B

Sign In for Pricing
View Details
ERalpha Polyclonal Antibody
MBS8593014-01 0.1 mg

ERalpha Polyclonal Antibody

Sign In for Pricing
View Details
ERalpha Polyclonal Antibody
MBS8593014-02 0.1 mL (AF405L)

ERalpha Polyclonal Antibody

Sign In for Pricing
View Details