Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NANOG Peptide - middle region

NANOG Peptide - middle region

Product Specifications

UniProt

Q6NSW7

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NANOG Rabbit Polyclonal Antibody (orb573693) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079141

Preservative

Lyophilized powder

AA Sequence

SYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSSYHQG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-CEBPB-T235 pAb
E9P1055 100 µL

Phospho-CEBPB-T235 pAb

Sign In for Pricing
View Details
Bovine SM ELISA Kit
EBS0041 96 Tests

Bovine SM ELISA Kit

Sign In for Pricing
View Details
Rabbit Monoclonal MOG Antibody (013) [Alexa Fluor 532]
NBP2-89453AF532 0.1 mL

Rabbit Monoclonal MOG Antibody (013) [Alexa Fluor 532]

Sign In for Pricing
View Details
FSCN1 Protein Vector (Human) (pPB-C-His)
PV016757 500 ng

FSCN1 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
AR Antibody (Center)
orb31314-01 50 µL

AR Antibody (Center)

Sign In for Pricing
View Details
AR Antibody (Center)
orb31314-02 100 µL

AR Antibody (Center)

Sign In for Pricing
View Details