Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nap1l5 Peptide - middle region

Nap1l5 Peptide - middle region

Product Specifications

Product Name Alternative

1110020M21Rik

UniProt

Q9JJF0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Nap1l5 Rabbit Polyclonal Antibody (orb582817) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_067407

Preservative

Lyophilized powder

AA Sequence

GDSAAAPAAEEPQAPAENAPKPKKDFMESLPNSVKCRVLALKKLQKRCDK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HMBOX1 Human Pre-designed siRNA Set A
HY-RS06223 1 Set

HMBOX1 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
VARS2 Rabbit Polyclonal Antibody (HRP)
orb2115371 100 µL

VARS2 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
NEUROG2 (Neurogenin 2, Atoh4, MGC46562, Math4A, NGN2, bHLHa8, ngn-2)
249257 200 µL

NEUROG2 (Neurogenin 2, Atoh4, MGC46562, Math4A, NGN2, bHLHa8, ngn-2)

Sign In for Pricing
View Details
Human Phosphodiesterase 5A ELISA Kit
MBS3802505-01 48 Well

Human Phosphodiesterase 5A ELISA Kit

Sign In for Pricing
View Details
Human Phosphodiesterase 5A ELISA Kit
MBS3802505-02 96 Well

Human Phosphodiesterase 5A ELISA Kit

Sign In for Pricing
View Details
Human Phosphodiesterase 5A ELISA Kit
MBS3802505-03 5x 96 Well

Human Phosphodiesterase 5A ELISA Kit

Sign In for Pricing
View Details