Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NARS Peptide - N-terminal region

NARS Peptide - N-terminal region

Product Specifications

Product Name Alternative

ASNRS, NARS1

UniProt

O43776

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NARS Rabbit Polyclonal Antibody (orb585040) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004530

Preservative

Lyophilized powder

AA Sequence

TIYVDSQKENERWNVISKSQLKNIKKMWHREQMKSESREKKEAEDSLRRE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MADCAM1 Mouse Monoclonal Antibody [Clone ID: OTI1C4]
TA507088 100 µL

MADCAM1 Mouse Monoclonal Antibody [Clone ID: OTI1C4]

Sign In for Pricing
View Details
SUMO3 Protein, Human, Recombinant
TMPJ-01021-01 10 µg

SUMO3 Protein, Human, Recombinant

Sign In for Pricing
View Details
SUMO3 Protein, Human, Recombinant
TMPJ-01021-02 20 µg

SUMO3 Protein, Human, Recombinant

Sign In for Pricing
View Details
SUMO3 Protein, Human, Recombinant
TMPJ-01021-03 50 µg

SUMO3 Protein, Human, Recombinant

Sign In for Pricing
View Details
SUMO3 Protein, Human, Recombinant
TMPJ-01021-04 100 µg

SUMO3 Protein, Human, Recombinant

Sign In for Pricing
View Details
SUMO3 Protein, Human, Recombinant
TMPJ-01021-05 200 µg

SUMO3 Protein, Human, Recombinant

Sign In for Pricing
View Details