Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NAT2 Peptide - middle region

NAT2 Peptide - middle region

Product Specifications

Product Name Alternative

AAC2, PNAT

UniProt

P11245

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NAT2 Rabbit Polyclonal Antibody (orb330372) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000006

Preservative

Lyophilized powder

AA Sequence

TYRKFNYKDNTDLVEFKTLTEEEVEEVLRNIFKISLGRNLVPKPGDGSLT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NKX2.5 Antibody
F45607-0.08ML 0.08 mL

NKX2.5 Antibody

Sign In for Pricing
View Details
IL21R Protein (C-mouse IgG1-Fc, Rat)
P525852 100 µg

IL21R Protein (C-mouse IgG1-Fc, Rat)

Sign In for Pricing
View Details
Vom2r29 Protein Vector (Rat) (pPM-C-HA)
PV315744 500 ng

Vom2r29 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
RIT1 Blocking Peptide
33R-10324 0.1 mg

RIT1 Blocking Peptide

Sign In for Pricing
View Details
Anti-FMN1 Antibody Picoband® Fluoro647 Conjugated
A07520-Fluoro647 100 µg/Vial

Anti-FMN1 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
Galectin-2, mouse recombinant
P1046-10 10 µg

Galectin-2, mouse recombinant

Sign In for Pricing
View Details