Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NAT2 Peptide - middle region

NAT2 Peptide - middle region

Product Specifications

Product Name Alternative

AAC2, PNAT

UniProt

P11245

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NAT2 Rabbit Polyclonal Antibody (orb330372) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000006

Preservative

Lyophilized powder

AA Sequence

TYRKFNYKDNTDLVEFKTLTEEEVEEVLRNIFKISLGRNLVPKPGDGSLT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human A Disintegrin And Metalloprotease 33 (ADAM33) ELISA Kit
orb2813333-01 48 Tests

Human A Disintegrin And Metalloprotease 33 (ADAM33) ELISA Kit

Sign In for Pricing
View Details
Human A Disintegrin And Metalloprotease 33 (ADAM33) ELISA Kit
orb2813333-02 96 Tests

Human A Disintegrin And Metalloprotease 33 (ADAM33) ELISA Kit

Sign In for Pricing
View Details
Human A Disintegrin And Metalloprotease 33 (ADAM33) ELISA Kit
orb2813333-03 5 x 96 T

Human A Disintegrin And Metalloprotease 33 (ADAM33) ELISA Kit

Sign In for Pricing
View Details
SRA1 Protein Vector (Rat) (pPM-C-His)
PV308005 500 ng

SRA1 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
PHC2 Protein Vector (Rat) (pPB-C-His)
PV293714 500 ng

PHC2 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Rat Ferritin (FE) ELISA Kit
MBS2024646-01 24 Strip Well

Rat Ferritin (FE) ELISA Kit

Sign In for Pricing
View Details