Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NAT8L Peptide - C-terminal region

NAT8L Peptide - C-terminal region

Product Specifications

Product Name Alternative

CML3, FLJ37478, MGC117272, NAT8-LIKE, NACED

UniProt

Q8N9F0

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NAT8L Rabbit Polyclonal Antibody (orb580662) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_848652

Preservative

Lyophilized powder

AA Sequence

VAAHKLYESLGFRHMGASDHYVLPGMTLSLAERLFFQVRYHRYRLQLREE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Ankfy1 activation kit by CRISPRa
GA200188 1 Kit

Mouse Ankfy1 activation kit by CRISPRa

Sign In for Pricing
View Details
TB501
TB5 10 Vials

TB501

Sign In for Pricing
View Details
Monocarboxyisodecyl Phthalate
456527-01 10 mg

Monocarboxyisodecyl Phthalate

Sign In for Pricing
View Details
Monocarboxyisodecyl Phthalate
456527-02 100 mg

Monocarboxyisodecyl Phthalate

Sign In for Pricing
View Details
Lactadherin antibody (FITC)
MBS5300699-01 0.1 mg

Lactadherin antibody (FITC)

Sign In for Pricing
View Details
Lactadherin antibody (FITC)
MBS5300699-02 5x 0.1 mg

Lactadherin antibody (FITC)

Sign In for Pricing
View Details