Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NAT8L Peptide - C-terminal region

NAT8L Peptide - C-terminal region

Product Specifications

Product Name Alternative

CML3, FLJ37478, MGC117272, NAT8-LIKE, NACED

UniProt

Q8N9F0

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NAT8L Rabbit Polyclonal Antibody (orb580662) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_848652

Preservative

Lyophilized powder

AA Sequence

VAAHKLYESLGFRHMGASDHYVLPGMTLSLAERLFFQVRYHRYRLQLREE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E. coli O157 Matched Antibody Pair Set [ABP-S-052723]
ABP-S-052723 5 Plates

E. coli O157 Matched Antibody Pair Set [ABP-S-052723]

Sign In for Pricing
View Details
TMEM30A Antibody
GWB-MQ766A 50 µg

TMEM30A Antibody

Sign In for Pricing
View Details
GPBP HDR Plasmid (h)
sc-408465-HDR 20 µg

GPBP HDR Plasmid (h)

Sign In for Pricing
View Details
H-L-Val-OtBu Hydrochloride
sc-285991 500 mg

H-L-Val-OtBu Hydrochloride

Sign In for Pricing
View Details
Fmoc-Cys(Mtt)-OH
B-3340.0005 5.0g

Fmoc-Cys(Mtt)-OH

Sign In for Pricing
View Details
Rabbit Anti-MUC13 antibody
SL10074R-01 50 µL

Rabbit Anti-MUC13 antibody

Sign In for Pricing
View Details