Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NAT9 Peptide - N-terminal region

NAT9 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DKFZP564C103, EBSP, hNATL

UniProt

Q9BTE0

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NAT9 Rabbit Polyclonal Antibody (orb580519) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056469

Preservative

Lyophilized powder

AA Sequence

MRLNQNTLLLGKKVVLVPYTSEHVPSRYHEWMKSEELQRLTASEPLTLEQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANP (NPPA) (N-term) Rabbit Polyclonal Antibody
AP18139PU-N 200 µL

ANP (NPPA) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD8A (Cytotoxic-&Suppressor T-Cell Marker) (rC8/468), CF640R conjugate, 0.1mg/mL
BNC401867-500 1x 500 µL

CD8A (Cytotoxic-&Suppressor T-Cell Marker) (rC8/468), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Small intestine
CS808294 5x 5 µm

Tissue FFPE Sections, Small intestine

Sign In for Pricing
View Details
Mouse 4921524L21Rik activation kit by CRISPRa
GA208661 1 Kit

Mouse 4921524L21Rik activation kit by CRISPRa

Sign In for Pricing
View Details
P40 (deltaNp63) (Squamous, Basal & Myoepithelial Cell Marker), CF488A conjugate, 0.1mg/mL
BNC882314-100 1x 100 µL

P40 (deltaNp63) (Squamous, Basal & Myoepithelial Cell Marker), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (NGFR/1997R), Biotin conjugate, 0.1mg/mL
BNCB1997-100 1x 100 µL

NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (NGFR/1997R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details