Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NCAM1 Peptide - C-terminal region

NCAM1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CD56, MSK39, NCAM

UniProt

P13591

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NCAM1 Rabbit Polyclonal Antibody (orb584515) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_851996

Preservative

Lyophilized powder

AA Sequence

AFFAKSAAIYNPVIYIMMNKQFRNCMLTTICCGKNPLGDDEASATVSKTE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OLAH CytoSection
TS408251P5 25 Slides

OLAH CytoSection

Sign In for Pricing
View Details
Lentiviral human DOCK7 shRNA (UAS) - Lentiviral human DOCK7 shRNA (UAS, RFP) (100)
GTR15088500 1 Vial

Lentiviral human DOCK7 shRNA (UAS) - Lentiviral human DOCK7 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Hanna ph 9.177 standard
Z655147-500ML 1 Each

Hanna ph 9.177 standard

Sign In for Pricing
View Details
*HAT Medium Supplement 50X, Liquid w/ 680.5 mg/litre Hypoxanthine, 8.8 mg/litre Aminopterin and 193.8 mg/litre Thymidine Phosphate Buffered Saline 10ml HAT Supplement is Suffcient for 500ml medium
TCL1072-01 5x 10 mL

*HAT Medium Supplement 50X, Liquid w/ 680.5 mg/litre Hypoxanthine, 8.8 mg/litre Aminopterin and 193.8 mg/litre Thymidine Phosphate Buffered Saline 10ml HAT Supplement is Suffcient for 500ml medium

Sign In for Pricing
View Details
*HAT Medium Supplement 50X, Liquid w/ 680.5 mg/litre Hypoxanthine, 8.8 mg/litre Aminopterin and 193.8 mg/litre Thymidine Phosphate Buffered Saline 10ml HAT Supplement is Suffcient for 500ml medium
TCL1072-02 100 mL

*HAT Medium Supplement 50X, Liquid w/ 680.5 mg/litre Hypoxanthine, 8.8 mg/litre Aminopterin and 193.8 mg/litre Thymidine Phosphate Buffered Saline 10ml HAT Supplement is Suffcient for 500ml medium

Sign In for Pricing
View Details
*HAT Medium Supplement 50X, Liquid w/ 680.5 mg/litre Hypoxanthine, 8.8 mg/litre Aminopterin and 193.8 mg/litre Thymidine Phosphate Buffered Saline 10ml HAT Supplement is Suffcient for 500ml medium
TCL1072-03 10x 10 mL

*HAT Medium Supplement 50X, Liquid w/ 680.5 mg/litre Hypoxanthine, 8.8 mg/litre Aminopterin and 193.8 mg/litre Thymidine Phosphate Buffered Saline 10ml HAT Supplement is Suffcient for 500ml medium

Sign In for Pricing
View Details