Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NCAM1 Peptide - C-terminal region

NCAM1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CD56, MSK39, NCAM

UniProt

P13591

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NCAM1 Rabbit Polyclonal Antibody (orb584515) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_851996

Preservative

Lyophilized powder

AA Sequence

AFFAKSAAIYNPVIYIMMNKQFRNCMLTTICCGKNPLGDDEASATVSKTE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LAR (7)
sc-135969 200 µg/mL

LAR (7)

Sign In for Pricing
View Details
Recombinant Human LRRC8B Protein - (Dry Ice)
H00023507-P01-25ug 25 µg

Recombinant Human LRRC8B Protein - (Dry Ice)

Sign In for Pricing
View Details
PIRC77 Protein Vector (Human) (pPM-C-His)
PV111469 500 ng

PIRC77 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Abcb10 antibody
70R-8569 50 ug

Abcb10 antibody

Sign In for Pricing
View Details
SV40 T Antigen antibody
10R-S128A 0.2 mg

SV40 T Antigen antibody

Sign In for Pricing
View Details
FAM125A (MVB12A) Rabbit Polyclonal Antibody
TA378806 100 µL

FAM125A (MVB12A) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details