Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ncoa4 Peptide - N-terminal region

Ncoa4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

1110034E15Rik, 4432406M01Rik, AI227008, ARA70, MGC103382, Rfg

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ncoa4 Rabbit Polyclonal Antibody (orb576401) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001029160

Preservative

Lyophilized powder

AA Sequence

CLIHQLEYTQNKDLANQVSVCLERLGSLALKPEDSTVLLFEADTSALRQT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pigeon Calpain 2, Large Subunit ELISA Kit
MBS060765 Inquire

Pigeon Calpain 2, Large Subunit ELISA Kit

Sign In for Pricing
View Details
LMOD1 Adenovirus (Rat)
26915056 1.0 mL

LMOD1 Adenovirus (Rat)

Sign In for Pricing
View Details
CLEC4E Mouse Monoclonal Antibody [Clone ID: OTI2A8]
TA505101S 30 µL

CLEC4E Mouse Monoclonal Antibody [Clone ID: OTI2A8]

Sign In for Pricing
View Details
Goat Anti-Human IgG
PAB21443-1000 1 Unit

Goat Anti-Human IgG

Sign In for Pricing
View Details
Peptidase inhibitor 16 (PI16) CytoSection
TS407631P5 25 Slides

Peptidase inhibitor 16 (PI16) CytoSection

Sign In for Pricing
View Details
XFD750 Anti-human CD27 Antibody *LT27*
102701B0-AAT 100 Tests

XFD750 Anti-human CD27 Antibody *LT27*

Sign In for Pricing
View Details