Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ncoa4 Peptide - N-terminal region

Ncoa4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

1110034E15Rik, 4432406M01Rik, AI227008, ARA70, MGC103382, Rfg

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ncoa4 Rabbit Polyclonal Antibody (orb576401) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001029160

Preservative

Lyophilized powder

AA Sequence

CLIHQLEYTQNKDLANQVSVCLERLGSLALKPEDSTVLLFEADTSALRQT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BAAT siRNA Oligos set (Human)
12966171 3x 5 nmol

BAAT siRNA Oligos set (Human)

Sign In for Pricing
View Details
Protein YIPF1 (YIPF1) Human ELISA Kit
G4487 96 Tests

Protein YIPF1 (YIPF1) Human ELISA Kit

Sign In for Pricing
View Details
CD45RA Antibody
orb1824272 100 µg

CD45RA Antibody

Sign In for Pricing
View Details
Hot Start Polymerase Ab+ (10 KU)
JBS-PCR-423-10KU 10 KU

Hot Start Polymerase Ab+ (10 KU)

Sign In for Pricing
View Details
Transglutaminase 2 (TGM2) Mouse Monoclonal Antibody [Clone ID: OTI1C4]
TA809186S 30 µL

Transglutaminase 2 (TGM2) Mouse Monoclonal Antibody [Clone ID: OTI1C4]

Sign In for Pricing
View Details
IGSF5 Knockout HAP1 Polyclonal Cells
ARG22732 1 Million

IGSF5 Knockout HAP1 Polyclonal Cells

Sign In for Pricing
View Details