Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NCOA5 Peptide - middle region

NCOA5 Peptide - middle region

Product Specifications

Product Name Alternative

CIA, bA465L10.6

UniProt

Q9HCD5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NCOA5 Rabbit Polyclonal Antibody (orb585374) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_066018

Preservative

Lyophilized powder

AA Sequence

CTVNIMFGTPQEHRNMPQADAMVLVARNYERYKNECREKEREEIARQAAK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RFP2 (TRIM13) activation kit by CRISPRa
GA106936 1 Kit

Human RFP2 (TRIM13) activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue Total RNA, Lung
CR560409 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details
Human SGCE activation kit by CRISPRa
GA105938 1 Kit

Human SGCE activation kit by CRISPRa

Sign In for Pricing
View Details
PREI3 (MOB4) Rabbit Polyclonal Antibody
TA365333 100 µL

PREI3 (MOB4) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ultrasonic Cleaner BULC-917
BULC-917 1 Unit

Ultrasonic Cleaner BULC-917

Sign In for Pricing
View Details
Cops2 Mouse Gene Knockout Kit (CRISPR)
KN503682 1 Kit

Cops2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details