Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ndfip2 Peptide - N-terminal region

Ndfip2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Ndfip2

UniProt

F1M5D2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ndfip2 Rabbit Polyclonal Antibody (orb580735) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

EDM02480

Preservative

Lyophilized powder

AA Sequence

YSSITVDGPTTSDADVYSEFYPVPPPYSVATSLPTYDEAEKAKAAALAAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human EVI5 shRNA (UAS) - Lentiviral human EVI5 shRNA (UAS, RFP) (25)
GTR15113123 1 Vial

Lentiviral human EVI5 shRNA (UAS) - Lentiviral human EVI5 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
CRKL, NT (CRKL, Crk-like protein) (Azide free) (HRP) discontinued
034232-HRP 200 µL

CRKL, NT (CRKL, Crk-like protein) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Colon adenocarcinoma tissue array, including pathology grade, TNM and clinical stage, 35 cases/35 cores
DCO352 35 Cases / 35 Cores

Colon adenocarcinoma tissue array, including pathology grade, TNM and clinical stage, 35 cases/35 cores

Sign In for Pricing
View Details
RAPGEF5/Repac Polyclonal Antibody, PE-Cy7 Conjugated
bs-11582R-PE-Cy7 100 µL

RAPGEF5/Repac Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
Dipotassium glycyrrhizinate
MBS3610470-01 50 mg

Dipotassium glycyrrhizinate

Sign In for Pricing
View Details
Dipotassium glycyrrhizinate
MBS3610470-02 5x 50 mg

Dipotassium glycyrrhizinate

Sign In for Pricing
View Details