Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ndfip2 Peptide - N-terminal region

Ndfip2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Ndfip2

UniProt

F1M5D2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ndfip2 Rabbit Polyclonal Antibody (orb580735) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

EDM02480

Preservative

Lyophilized powder

AA Sequence

YSSITVDGPTTSDADVYSEFYPVPPPYSVATSLPTYDEAEKAKAAALAAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal GBP1 Antibody (GBP1/7618) [DyLight 755]
NBP3-26941IR 0.1 mL

Mouse Monoclonal GBP1 Antibody (GBP1/7618) [DyLight 755]

Sign In for Pricing
View Details
Human E2F3 (E2F Transcription Factor 3) ELISA Kit
EK244025 96 Well

Human E2F3 (E2F Transcription Factor 3) ELISA Kit

Sign In for Pricing
View Details
Apocynum venetum Extract
C02708 5 mg

Apocynum venetum Extract

Sign In for Pricing
View Details
Olr1308 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
33827116 3x 1.0 µg

Olr1308 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
PRDM2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV660253 1.0 µg DNA

PRDM2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Horse Serrate RNA Effector Molecule Homolog (SRRT) ELISA Kit
MBS9910204-01 48 Well

Horse Serrate RNA Effector Molecule Homolog (SRRT) ELISA Kit

Sign In for Pricing
View Details