Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDFIP2 Peptide - middle region

NDFIP2 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ25842, KIAA1165, N4wbp5a, N4WBP5A

UniProt

Q9NV92

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NDFIP2 Rabbit Polyclonal Antibody (orb580736) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061953

Preservative

Lyophilized powder

AA Sequence

SFCITNTIAGRYGAICGFGLSLIKWILIVRFSDYFTGYFNGQYWLWWIFL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(4-Pyridyl) acetone
orb3023691-01 50 mg

(4-Pyridyl) acetone

Sign In for Pricing
View Details
(4-Pyridyl) acetone
orb3023691-02 100 mg

(4-Pyridyl) acetone

Sign In for Pricing
View Details
GPR108 (NM_001080452) Human Over-expression Lysate
LS056927-20ug 20 µg

GPR108 (NM_001080452) Human Over-expression Lysate

Sign In for Pricing
View Details
FBP1 Rabbit Polyclonal Antibody (Biotin)
orb2081731 100 µL

FBP1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
MG Basal Salt Medium (Powder) discontinued
299677-01 5x 30 g

MG Basal Salt Medium (Powder) discontinued

Sign In for Pricing
View Details
MG Basal Salt Medium (Powder) discontinued
299677-02 10 x 30 g

MG Basal Salt Medium (Powder) discontinued

Sign In for Pricing
View Details